DNA-binding protein 7a

Sulfolobus solfataricus

1B4O

P61991

ATVKFKYKGEEKQVDISKIKKVWRVGKMISATYDEGGGKTGRGAVSEKDAPKELLQMLEKQK