DNA-binding protein 7a

Sulfolobus solfataricus

1SSO

P61991

ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK