DNA-binding protein 7d

Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

1JIC,5B03,5B02,1BNZ,5U1C,5GWW,1BBX,5GWV,5B0I,5B0K,5B0J,5B0M,5B0L,1C8C

P39476

MATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK