Fatty acid-binding protein, heart

Homo sapiens

5HZ9,1HMR,2HMB,1HMT,3RSW,4WBK,1G5W,5B27,5CE4,5B28,4TJZ,5B29,1HMS,4TKH,4TKJ,3WBG,3WXQ,3WVM,4TKB

P05413

MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA