Cold shock protein CspB

Bacillus caldolyticus

1HZA,5JX4,1HZC,1HZB,2HAX,1C9O,1I5F,1HZ9

P41016

MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL