50S ribosomal protein L9

Geobacillus stearothermophilus

2HVF,2HBA,2HBB,1CQU,4V4T,1DIV

P02417

MKVIFLKDVKGKGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQKEQRQAAEELANAKKLKEQLEKLTVTIPAKAGEGGRLFGSITSKQIAESLQAQHGLKLDKRKIELADAIRALGYTNVPVKLHPEVTATLKVHVTEQK