DNA-binding protein 7d

Sulfolobus acidocaldarius

1AZP

P13123

A:MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK/B:GCGATCGC/C:GCGATCGC