General odorant-binding protein lush

Drosophila melanogaster

3B88,3B87,1OOI,3B7A,3B86,1OOG,1OOF,2GTE,3B6X,1T14,1OOH,2QDI

O02372

MKHWKRRSSAVFAIVLQVLVLLLPDPAVAMTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP