Fatty acid-binding protein, intestinal

Rattus norvegicus

1URE,3AKN,1ICN,1ICM,1DC9,1AEL,1T8V,2IFB,1A57,1SA8,1IFB,1IFC

P02693

MAFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE