SH3 DOMAIN OF HUMAN LYN TYROSINE KINASE

Homo sapiens

1W1F

P07948

GSPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNT