Ribonucleoside-diphosphate reductase, beta subunit

Aerococcus urinae

None

F2I8X9

MTKNYYDRSVSPVEYAYFDQSQNMRAINWNKIVDEKDLEVWNRVTQNFWLPENIPVSNDLPSWNELDDDWQQLITRTFTGLTLLDTVQSSIGDVAQIKNSLTEQEQVIYANFAFMVGVHARSYGTIFSTLCTSEQIEEAHEWVVDNEALQARPKALIPFYTADDPLKSKIAAALMPGFLLYGGFYLPFYLSARGKLPNTSDIIRLILRDKVIHNFYSGYKYQLKVAKLSPEKQAEMKQFVFDLLDKMIGLEKTYLHQLYDGFGLADEAIRFSLYNAGKFLQNLGYESPFTKEETRIAPEVFAQLSARADENHDFFSGSGSSYIIGTSEETLDEDWDF