Immunoglobulin G-binding protein G

Streptococcus sp. group G

2GB1

P06654

MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE