thermostability

NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPSIWDTFCQIPGKVIGGDCGDVACDHFHHFKEDVQLMKQLGFLHYRFSVAWPRIMPAAGIINEEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIEDEGGWTQRETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTGEHAPGHENWREAFTAAHHILMCHGIASNLHKEKGLTGKIGITLNMEHVDAASERPEDVAAAIRRDGFINRWFAEPLFNGKYPEDMVEWYGTYLNGLDFVQPGDMELIQQPGDFLGINYYTRSIIRSTNDASLLQVEQVHMEEPVTDMGWEIHPESFYKLLTRIEKDFSKGLPILITENGAAMRDELVNGQIEDTGRHGYIEEHLKACHRFIEEGGQLKGYFVWSFLDNFEWAWGYSKRFGIVHINYETQERTPKQSALWFKQMMAKNGF

single point mutations

1

WTnumMUT

File Description

Column Assay/Protocol
2 Sequence Description
3 Computational Protocol: deep_ddg
4 Computational Protocol: automute_dTm
5 Computational Protocol: automute_ddg
6 Computational Protocol: HotMusic_dTm
7 Computational Protocol: sdm_ddg
8 Computational Protocol: popmusic_ddg
9 Computational Protocol: elaspic_ddg
10 Experimental Assay: Tm
11 Experimental Assay: T50
12 Computational Protocol: rosetta_total
13 Computational Protocol: rosetta_fa_atr
14 Computational Protocol: rosetta_fa_rep
15 Computational Protocol: rosetta_fa_sol
16 Computational Protocol: rosetta_fa_intra_rep
17 Computational Protocol: rosetta_fa_intra_sol_xover4
18 Computational Protocol: rosetta_lk_ball_wtd
19 Computational Protocol: rosetta_fa_elec
20 Computational Protocol: rosetta_pro_close
21 Computational Protocol: rosetta_hbond_sr_bb
22 Computational Protocol: rosetta_hbond_lr_bb
23 Computational Protocol: rosetta_hbond_bb_sc
24 Computational Protocol: rosetta_hbond_sc
25 Computational Protocol: rosetta_dslf_fa13
26 Computational Protocol: rosetta_omega
27 Computational Protocol: rosetta_fa_dunn
28 Computational Protocol: rosetta_p_aa_pp
29 Computational Protocol: rosetta_yhh_planarity
30 Computational Protocol: rosetta_ref
31 Computational Protocol: rosetta_rama_prepro
32 Computational Protocol: foldx_total_energy
33 Computational Protocol: foldx_Backbone_Hbond
34 Computational Protocol: foldx_Sidechain_Hbond
35 Computational Protocol: foldx_Van_der_Waals
36 Computational Protocol: foldx_Electrostatics
37 Computational Protocol: foldx_Solvation_Polar
38 Computational Protocol: foldx_Solvation_Hydrophobic
39 Computational Protocol: foldx_Van_der_Waals_clashes
40 Computational Protocol: foldx_entropy_sidechain
41 Computational Protocol: foldx_entropy_mainchain
42 Computational Protocol: foldx_sloop_entropy
43 Computational Protocol: foldx_mloop_entropy
44 Computational Protocol: foldx_cis_bond
45 Computational Protocol: foldx_torisional_clash
46 Computational Protocol: foldx_backbone_clash
47 Computational Protocol: foldx_helix_dipole
48 Computational Protocol: foldx_water_bridge
49 Computational Protocol: foldx_disulfide
50 Computational Protocol: foldx_electrostatic_kon
51 Computational Protocol: foldx_partial_covalent_bonds
52 Computational Protocol: foldx_energy_Ionisation
53 Computational Protocol: foldx_Entropy_Complex