Catalytic efficiency measured in kcat/Km for all the kemp eliminases of the HG series

EAAQSVDQLIKARGKVYFGVATDQNRLTTGKNAAIIQADFGMVWPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIGGGMLVWHSQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVGEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYIMDYNLDSASYPKTQAIVNRVKQWRAAGVPIDGIGSQTHLSAGQGAGVLQALPLLASAGTPEVSILMLDVAGASPTDYVNVVNACLNVQSCVGITVFGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQDLQQGSIEGRGHHHHHH

none

1

WTnumMUT

File Description

Column Assay/Protocol