Kinetic Assay Data

ENZYME_IM:DDSLPDLKIEKLEKGVYVHTSFEEVKGWGVVTKHGLVVLVKNDAYLIDTPITAKDTEKLVNWFIEHGYRIKGSISTHFHGDSTAGIEWLNSQSISTYASELTNELLKKDNKVQATNSFSGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGNASLLQRTWEQAVKGLNESKKPLQPSS/SMMOL_BL:CC1(C(N2C(S1)C(C2=O)NC(=O)C(C3=CC=CC=C3)N)C(=O)O)C

IM:all/BL:

IM:1/BL:1

IM:WTnumMUT/BL:FullSeq

File Description

Column Assay/Protocol
1 Sequence Description
4 Sequence Description
5 Experimental Assay: kcat
6 Derived Quantity: SD of kcat
7 Experimental Assay: Km
8 Derived Quantity: SD of Km
9 Experimental Assay: kcat/Km
10 Derived Quantity: SD of kcat/Km