biophysical properties of the clinical-stage antibody landscape

L:DIQMTQSPSTLSASVGDRVTITCRASQSINTWLAWYQQKPGKAPKLLMYKASSLESGVPSRFIGSGSGTEFTLTISSLQPDDFATYYCQQYNSDSKMFGQGTKVEVKGTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC/H:QVQLVQSGGGVVQPGRSLRLSCAASGFTFSRYTIHWVRQAPGKGLEWVAVMSYNGNNKHYADSVNGRFTISRNDSKNTLYLNMNSLRPEDTAVYYCARIRDTAMFFAHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

L:all/H:all

L:1/H:1

L:FullSeq/H:FullSeq

File Description

Column Assay/Protocol
1 Sequence Description
2 Sequence Description
3 Experimental Assay: HEK titer
4 Experimental Assay: Tm
5 Experimental Assay: salt-gradient affinity-capture self-interaction nanoparticle spectroscopy (SGAC-SINS)
6 Experimental Assay: hydrophobic interaction chromatography (HIC)
7 Experimental Assay: standup monolayer adsorption chromatography (SMAC)
8 Experimental Assay: size-exclusion chromatography (SEC)
9 Experimental Assay: polyspecificity reagent (PSR)
10 Experimental Assay: Affinity-Capture Self-Interaction Nanoparticle Spectroscopy (AC-SINS)
11 Experimental Assay: cross-interaction chromatography (CIC)
12 Experimental Assay: clone self-interaction by biolayer interferometry (CSI-BLI)
13 Experimental Assay: ELISA
14 Experimental Assay: Baculovirus particle ELISA (BVP ELISA)