Activity Data

SMMOL_BL:CC(=O)OCC1=C(N2C(C(C2=O)NC(=O)CC3=CC=CS3)SC1)C(=O)O/ENZYME_IM:AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN

BL:

BL:1

BL:FullSeq

File Description

Column Assay/Protocol
1 Sequence Description
3 Sequence Description
4 Experimental Assay: kcat
5 Derived Quantity: SD of kcat
6 Experimental Assay: Km
7 Derived Quantity: SD of Km
8 Experimental Assay: kcat/Km
9 Derived Quantity: SD of kcat/Km
10 Experimental Assay: MIC relative
12 Experimental Assay: MIC absolute
13 Experimental Assay: Resistance