Inhibition

SMMOL_IN:C1=CC=C(C=C1)CC2=CC(=C(C(=C2)[N+](=O)[O-])O)C=NC3=CC(=C(C=C3)C4=NC5=CC=CC=C5S4)O/ENZYME_IM:AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN

IM:all/IN:

IM:1/IN:1

IM:WTnumMUT/IN:FullSeq

File Description

Column Assay/Protocol
1 Sequence Description
2 Sequence Description
3 Experimental Assay: Inhibition
4 Derived Quantity: SD of Inhibition