Variants for mAb7_heavy_light

ANTIBODY_L:DIVMTQTPLSLPVTPGQPASISCRSSQSLVHSNGNTYLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTHVPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG/ANTIBODY_H:EVQLVESGPGLVKPSETLSLSCTVSGDSITSGFWNWIRQPPGKGLEWIGYIGFSGSTYYNPSLKSRVTISRDTSKNQYSLKLSSVTAADTAVYYCASVDNSAALDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP

H:all/L:all

H:1/L:1

H:WTnumMUT/L:WTnumMUT

File Description

Column Assay/Protocol
2 Sequence Description
3 Sequence Description
4 Computational Protocol: Overall CamSol score
5 Computational Protocol: Heavy Chain CamSol score
6 Computational Protocol: Light Chain CamSol score
7 Experimental Assay: Tm1
8 Experimental Assay: Tm2
9 Experimental Assay: Purity
10 Experimental Assay: Hydrodynamic Radius Rh
11 Derived Quantity: SD of Hydrodynamic Radius Rh
12 Computational Protocol: Theoretical Isoelectric Point (pI)
13 Experimental Assay: Experimental Isoelectric Point (pI)