Variants for Fragment_TcdA_sdAb

PROT_A:AATGWVTIDGRRYYFEPNTAIGANGYKIIDNKNFYFRNGLPQIGVFKGPNGFEYFAPANTDANNIDGQAIRYQNRFLHLLGNIYYFGNNSKAVTGWQTINGNMYYFMPDTAMAAAGGLFEIDGVIYFFGVDGVKAPGIYG/ANTIBODY_B:QVKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSS

A:all/B:all

A:123/B:1

A:WTnumMUT/B:WTnumMUT

File Description

Column Assay/Protocol
1 Sequence Description
2 Sequence Description
3 Computational Protocol: Z-Score