Variants for Full_TcdA_sdAb

ANTIBODY_B:QVKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSSHHHHHH/PROT_A:MHHHHHHGMRTIDGKKYYFNTNTAEAATGWQTIDGKKYYFNTNTSIASTGYTIINDKHFYFNTDGIMQIGVFKGPDGFEYFAPANTDANNIEGQAIRYQNRFLYLHDNIYYFGNNSKAATGWVTIDGRRYYFEPNTAIGANGYKIIDNKNFYFRNGLPQIGVFKGPNGFEYFAPANTDANNIDGQAIRYQNRFLHLLGNIYYFGNNSKAVTGWQTINGNMYYFMPDTAMAAAGGLFEIDGVIYFFGVDGVKAPGIY

A:all/B:all

A:1/B:1

A:WTnumMUT/B:WTnumMUT

File Description

Column Assay/Protocol
1 Sequence Description
2 Sequence Description
4 Experimental Assay: kon
5 Derived Quantity: SD of kon
6 Experimental Assay: koff
7 Derived Quantity: SD of koff
8 Experimental Assay: Kd
9 Derived Quantity: SD of Kd
12 Derived Quantity: Kd_WT/Kd_Mutant
13 Derived Quantity: ΔΔG