Variants for sdAb A26.8

QVKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSSHHHHHH

all

1

WTnumMUT

File Description

Column Assay/Protocol
2 Sequence Description
10 Experimental Assay: Tm
11 Derived Quantity: SD of Tm