Variants for Binding (O2 and CO)

SMMOL_SM:CCN1C2=C(C=C(C=C2)S(=O)(=O)O)SC1=NN=C3N(C4=C(S3)C=C(C=C4)S(=O)(=O)O)CC/ENZYME_A:GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG

A:all/SM:all

A:1/SM:1

A:WTnumMUT/SM:FullSeq

File Description

Column Assay/Protocol
1 Sequence Description
2 Sequence Description
3 Experimental Assay: Binding: kon
4 Experimental Assay: Binding: koff for O2
5 Derived Quantity: Binding: Ka for O2
6 Experimental Assay: Binding: koff for CO
7 Derived Quantity: Binding: Ka for CO