Inferred folding and binding energies from thermodynamic model

MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE

all

1

WTnumMUT

File Description

Column Assay/Protocol
1 Sequence Description
2 Computational Protocol: Folding energies (DDG)
3 Computational Protocol: Energy change upon binding (DDG)