Variants for Alpha-1-proteinase inhibitor

PROT_A:DTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPM/PROT_B:SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

all

1

WTnumMUT

File Description

Column Assay/Protocol
1 Sequence Description
2 Sequence Description
4 Experimental Assay: Total soluble protein content
5 Experimental Assay: Recombinant protein content
6 Derived Quantity: SD of Recombinant protein content