Kd by yeast display of scFvs derived from Abs isolated from bone marrow and spleen (Table 2)

ANTIGEN_Ri:IFPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFILVELSNHAELSVTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAFGGNYDRLEQLAGNLRENIELGNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAARFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSKFSVYDVSILIPIIALMVYRCAPPPSSQF/PROT_Fv:DIVLTQSPAIMSASPGEKVTISCSATSNVNYMYWYQQKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQYHNYPRTFGGGTKLEIKRGGGGSGGGGSGGGGSQVQLQQSGAELVKPGASVKLSCKASGYTFTNYFLYWVKQRPGQGLEWIGEINPNNGGTNFNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCTRSEYVNFGWFAYWGQGTLVTVSA

1

WTnumMUT

File Description

Column Assay/Protocol
2 Sequence Description
3 Experimental Assay: Kd - yeast display