fitness

A:MANVEKMSVAVTPQQAAVMREAVEAGEYATASEIVREAVRDWLAKRELRHDDIRRLRQLWDEGKASGRPEPVDFDALRKEARQKLTEVPPNGR/B:MGSSHHHHHHSQDPMAVRLVWSPTAKADLIDIYVMIGSENIRAADRYYDQLEARALQLADQPRMGVRRPDIRPSARMLVEAPFVLLYETVPDTDDGPVEWVEIVRVVDGRRDLNRLF

1

WTnumMUT

File Description

Column Assay/Protocol
1 Sequence Description
2 Experimental Assay: fitness (log-fold expansion of each mutant relative to the population)