Stability of FGF-1 and Binding to FGFRs

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

1

WTnumMUT

File Description

Column Assay/Protocol
1 Sequence Description
2 Experimental Assay: T_den (Circular Dichroism)
3 Derived Quantity: SEM of T_den (Circular Dichroism)
4 Derived Quantity: ∆T_den (Circular Dichroism)
5 Experimental Assay: ∆H_den (Circular Dichroism)
6 Derived Quantity: SEM of ∆H_den (Circular Dichroism)
7 Experimental Assay: T_den (Fluorescence Spectroscopy)
8 Derived Quantity: SEM of T_den (Fluorescence Spectroscopy)
9 Derived Quantity: ΔT_den (Fluorescence Spectroscopy)
10 Experimental Assay: ∆H_den (Fluorescence Spectroscopy)
11 Derived Quantity: SEM of ∆H_den (Fluorescence Spectroscopy)
12 Experimental Assay: IC50 (+Heparin): serum-starved NIH 3T3 cells to incorporate [3H]thymidine
13 Derived Quantity: SEM of IC50 (+Heparin): serum-starved NIH 3T3 cells to incorporate [3H]thymidine
14 Derived Quantity: IC50 (+Heparin): Ratio
15 Derived Quantity: SEM of IC50 (+Heparin): Ratio
16 Experimental Assay: EC50 (+Heparin): [3H]thymidine incorporation in response to the stimulation of NIH 3T3
17 Derived Quantity: SEM of EC50 (+Heparin): [3H]thymidine incorporation in response to the stimulation of NIH 3T3
18 Derived Quantity: EC50 (+Heparin): Ratio
19 Derived Quantity: SEM of EC50 (+Heparin): Ratio