Mutations for sequence A:GIVEQCCTSICSLYQLENYCN/B:FVNQHLCGSHLVEALYLVCGERGFFYTPKT/C:GIVEQCCTSICSLYQLENYCN/D:FVNQHLCGSHLVEALYLVCGERGFFYTPKT/E:GIVEQCCTSICSLYQLENYCN/F:FVNQHLCGSHLVEALYLVCGERGFFYTPKT/G:GIVEQCCTSICSLYQLENYCN/H:FVNQHLCGSHLVEALYLVCGERGFFYTPKT/I:GIVEQCCTSICSLYQLENYCN/J:FVNQHLCGSHLVEALYLVCGERGFFYTPKT/K:GIVEQCCTSICSLYQLENYCN/L:FVNQHLCGSHLVEALYLVCGERGFFYTPKT

A:GIVEQCCTSICSLYQLENYCN/B:FVNQHLCGSHLVEALYLVCGERGFFYTPKT/C:GIVEQCCTSICSLYQLENYCN/D:FVNQHLCGSHLVEALYLVCGERGFFYTPKT/E:GIVEQCCTSICSLYQLENYCN/F:FVNQHLCGSHLVEALYLVCGERGFFYTPKT/G:GIVEQCCTSICSLYQLENYCN/H:FVNQHLCGSHLVEALYLVCGERGFFYTPKT/I:GIVEQCCTSICSLYQLENYCN/J:FVNQHLCGSHLVEALYLVCGERGFFYTPKT/K:GIVEQCCTSICSLYQLENYCN/L:FVNQHLCGSHLVEALYLVCGERGFFYTPKT

None

1

WTnumMUT

File Description

Column Assay/Protocol