in vitro selection of 4 boundary positions compared to CPD variants (Table 2)

MQFKLIINGKTLKGETTTEAVDAATAEKVFKQYANDNGIDGEWTYDDATKTFTVTE

16,18,25,29

1

MutatedResRange

File Description

Column Assay/Protocol
1 Experimental Assay: Tm in 2.5M GdmCl pH7.0
2 Experimental Assay: ΔHD(Tm)
3 Experimental Assay: ΔGD (70°C)
4 Derived Quantity: ΔΔGD(70°C)
5 Derived Quantity: SEM of Tm in 2.5M GdmCl, pH7.0
6 Derived Quantity: SEM of ΔHD(Tm)
7 Derived Quantity: SEM of ΔGD (70°C)
8 Sequence Description